Protein Purification
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ InSolution™ APT1 Inhibitor, palmostatin B
A 50 mM (2 mg/106.23 μL) sterile-filtered solution of APT1 Inhibitor, palmostatin B in DMSO.
MilliporeSigma™ Calbiochem™ MG-132, ≥95% by HPLC
Potent, reversible, and cell-permeable proteasome inhibitor (Ki = 4 nM).
MilliporeSigma™ Calbiochem™ MK-2 Inhibitor III
The MK-2 Inhibitor III, also referenced under CAS 1186648-22-5, controls the biological activity of MK-2. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ NG-Nitro-L-arginine Methyl Ester, Hydrochloride
Cell permeable. More soluble analog of arginine and a competitive, slowly reversible inhibitor of eNOS (IC50 = 500nM). Causes a prolonged inhibition of acetylcholine-induced relaxation of rat aortic rings (IC50 = 400nM).
MilliporeSigma™ Calbiochem™ (--)-Nicotine, Ditartrate
Potent agonist of the nicotinic acetylcholine receptor.
MilliporeSigma™ Calbiochem™ α-Naphthyl Acid Phosphate, Monosodium Salt
α-Naphthyl Acid Phosphate, Monosodium Salt - CAS 81012-89-7, is a broad-spectrum protein phosphatase inhibitor.
MilliporeSigma™ Calbiochem™ Necrostatin-1, Inactive Control
A cell-permeable N-demethylated thiohydantoin analog of Nec-1 that is devoid of anti-necroptotic properties and serves as a suitable inactive control.
MilliporeSigma™ Calbiochem™ Ouabain, Octahydrate
Inhibits Na+,K+-ATPase.
MilliporeSigma™ Calbiochem™ Notch Transcription Factor Inhibitor, SAHM1
Notch Transcription Factor Inhibitor, SAHM1, is a cell-permeable inhibitor that prevents assembly in the NOTCH1 trans-activation complex.
Invitrogen™ MAGnify™ Chromatin Immunoprecipitation System
Streamlined, optimized assay for the enrichment of chromatin/protein complexes and DNA recovery using magnetic bead capture technology.
MilliporeSigma™ Calbiochem™ InSolution™ Nocodazole
Inhibitor of mitosis. Has highly specific antimicrotubular activity for mammalian cells in culture.
MilliporeSigma™ Calbiochem™ Adenosine 3',5'-cyclic Monophosphate, 8-(4-Chlorophenylthio)-, Sodium Salt
Cell-permeable cAMP analog that activates both protein kinase A and protein kinase G.
MilliporeSigma™ Calbiochem™ Adenosine Receptor Agonist, NECA
A cell-permeable adenosine analog that acts a potent non-selective agonist of adenosine receptors (Ki = 14 nM, 20 nM
Thermo Scientific™ SILAC Protein Quantitation Kit (Trypsin), DMEM
The Thermo Scientific SILAC Protein Quantitation Kit (Trypsin), DMEM, is used for the specific analysis of protein expression by mass spectrometry using stable isotope labeling with amino acids in cell culture (SILAC).